Fort Langley Village Farmers’ Market
2021 Season
Saturdays
April 10th – December 18th – 9:00 AM – 3:00 PM
**************************************************
Fort Langley Farmers’ Market Facebook Page
Join us at our next B.C. Farmers Market and meet our
local BC farmers, BC Prepared food vendors,
and our “Best of BC” Artisans.
Every Saturday 9:00 am – 3:00 pm. April 10th – December 18th, 2021
Our Market is located at:
9025 Glover Road
Fort Langley B.C.
(site of St. Andrew’s Historic Chapel)
ALSO announcing
“Christmas in the Village”
4th, 11th, 18th December
Special Christmas Festival Markets
~ <> ~
“Continuing Fort Langley’s Historic Trading Traditions”
At one point in history, Hudson Bay’s Fort Langley farm totalled over six thousand acres!
NOTE: (2021/09/16):
The BC-CDC has lifted the Covid-19 Emergency.
Also, BC Farmers Market customers are not required to wear masks, nor do we ask customers for proof of vaccination.
Therefore we are operating as normal under BCAFM & BC CDC Health & Safety Rules and regulations.
Thank you for all your support during the emergency from March 2020 to July 1st, 2021.
Stay Healthy and Stay Safe in 2021 and beyond.
Providing Local BC Farm Produce and BC Prepared Foods:
Fort Langley Village Farmers’ Market is an authentic B.C. Farmers’ Market and features Local Organic Farms and Certified Safe BC Prepared Food Vendors bringing in fresh local produce, field greens, vegetables, fruits, fresh baked bread & pastries, fruit pies, fresh baked cookies, organic honey, local craft beers, varietal BC wines & Spirits, tasty prepared sauces & salad dressings, BC Fruit jams and pickles, all made with BC grown produce from our local Fort Langley & Langley Township, Fraser Valley, Similkameen, Okanagan & Creston Valley Farms.
2021 Fort Langley Farmers’ Market Season Vendors:
Please Note: Not all vendors attend each and every market.
B.C. Fresh Farm Produce, Fruits, Vegetables, Flowers & Plants:
– Wilde Wunder Gardens, Fresh field greens & vegetables, flowers, plants and fruits
– Christina’s Garden, Fresh local Langley greens, tomatoes, garlic, peppers, fruits & grapevines
– Black Table Farm, Fresh local Langley greens & vegetables
– Andor Farms, Fresh local Langley greens, vegetables and fruits. Co-op table.
– Craigentinney Farms, Grassfed Beef and Pork, eggs and vegetables, Fort Langley
– Maan Farms, Fresh Langley Farm local fruit berries, and delicious berry wines
– MicroGreenery, varieties of healthy microgreens
– J&D Farm, Orchids, Microgreens, fresh vegetables, and baking.
– Farm Werks, Vegetables, Eggs and fruits, by David Alsop
– Summer Breeze Farm, Fresh organic farm fruits brought to market from the Similkameen Valley
– The Bog Riverside Cranberry Farm, by Mandy and Brian
– Personal Touch, Varieties of Succulents and other plants
– Tropical Hobbyist, Indoor Plants
B.C. Prepared Foods & Baking etc.
– The Bread Shop, Fresh baking by Amanda
– Golden Meadows Honey Farm, by Lydia
– Gabi & Jules, Homemade Pies, and Goodness, Baking
– Simply Delish Soups & Salads, Gourmet soups
– Gramma Ruth’s Home Made Cookies, By Gramma Ruth
– European Flavour Factory, by Vivian
– Oxford Ice Cream, by Andrea & Brendan, delicious natural flavours
– The Larks Nest, Fruit jams and pickles by Jackie Lark
– Hiveology – Okanagan Honey by Brad & Jennifer
– COCONAMA Chocolates, by Takanori Chiwata
– Yukolicious Artisanal Foods, by Yuko
– The Bearded Baker, Lance
– Gingeraki Gingershot, by 4Immunity
– Infusion Soy Sauces, by Jason Nichol
– BAK’D Cookies, by Jessica
– O Croissants, delicious french baking
– Amazing Foods BC, Fabulous Curries by Mandy
– Deb’s Best Kombucha, by Deb
– Zoomers Foods, Super-Mushroom coffee by Todd
– Keto-Vego, Protein Bars
– Goldsmith Dressings, garlic salad dressings by Amber
– Damiani Fine Foods, by Sandra Damiani
– Scratch Fine Foods Fresh Koji and cultured Chili Sauces
– PJ’s Smokehouse – Island Jerky, by Michelle
– Maison Cote, huge variety of fine cooking spices with Jean-Pierre Cote
– Raphael’s Caribbean Spices, Delicious with chicken, beef or vegetable
– The Perogie Hut, Hot & Frozen perogies by Judy & Lawrence
– Eat The Real Patty, Hot Jamaican Patty’s
– Pretty Bird Ice Cream, by Dave
– Chocolate and Whisks, by Ashley
– Bon Mano Bon Foods, Chocolate nuts by Jason
– Boneheads Kitchen, Fresh foods and treats for dogs
– Bob the Dog, Dog food and treats
– Boneheads, Dog foods for your pet
– Sweetpop, Flavoured Popcorns
– Dipsy Doodle Candy, by Dani
– Fort Langley Barkery, Petfoods
B.C. Craft Beers, Wines & Spirits:
– Trading Post Brewing, Local Craft beer from Langley
– Locality Brewing, Local Craft Beer
– Fuggles & Warlock Craftworks
– Mainland Whisky, Surrey BC
– Crescent Hill Winery, delicious Okanagan wines, including vegan varietal
– Canada Mead Brewing Ltd. , Ming Li
– Odd Society Spirits, Vancouver
“Made in BC” Fresh Natural Soaps, Oils, Bath Products:
– Just Pure & Simple Bath & Body, Natural Soaps & Oils
– Ancient Mantra Naturals, by Raman Mand
– TMC Natural Creams & Oils, by Marilyn
– Essentia Aromatherapy by Emily Taylor
B.C. Local Artisans, Painters, Arts & Crafts:
– “Ali’s Pebbies and Gems“, Hand made jewels by Ali
– “Jewelalicious” Hand Made Jewelry, by Debbie
– Sticks and Stones Art Works, by Jacqui Ross
– Strokes and Stitched, Paintings by Patty Ridley
– The Little House Company & Fort Langley Lathery, by Kevin & Susan McClain
– Whimsy’s Jewels, by Sasha Van De Keere
– Margaret’s Sew Cozy, by Margaret Ada
– Jan’s Pans and Collectables, by Jan
– Unique Handcrafted & Repurposed Creations, by Shirley
– Rustic Rose All Naturals, by Rhonda, “A little Jar of Wow”
– Personal Touch Handcrafted, by Susan Purton
– Baroness Ashley Hats, by Michael Chung
– Rita Anderson, Watercolour Artist, Prints & Painting
– CARDS by EM, greeting cards and wedding invitations
– Mamma’s Little Man, Children’s clothing
– The 6th Scent Candle by Allie Lee
– Loving the Bling, by Val
– Pen on Paper, Artwork by Jennifer Delaney
– Cindy’s Fairy Gardens, by Cindy
Community Service Organisations:
– United Churches of Langley, Friends of St. Andrew’s Chapel
– Fort Langley Lions Club
– Fort Langley Community Association
– Boundary Bay Vet Specialty Hospital, Blood Bank for Animals
– Rotary Club of Langley
– Wounded Warriors, Assistance Dog Training for Vets
– Langley Emergency Preparedness Program
– Heritage Fort Langley
– Fort Langley’s BC Farm Machinery & Agriculture Museum
– Fort Langley’s National Historic Fort, the Blacksmith
============================
GET ON OUR FALL/WINTER/CHRISTMAS VENDOR LISTS FOR 2021`
Fort Langley Village Farmers’ Market 2021
Please send us an email with your Vender details and Contacts to:
info@fortlangleyvillagefarmersmarket.org
Or contact us at 604-728-2080 or
Send us an email request to info@fortlangleyvillagefarmersmarket.org
You must include name, phone number, vendor category, etc.
Thank you for your interest in our markets!
Fort Langley Village Farmers Market 2021
============================
604-728-2080
Member: B.C. Association of Farmers’ Markets
Member: Fort Langley Community Association
Member: BC Farm Museum
Member: Langley Emergency Preparedness Program
Member: Heritage Fort Langley
Fort Langley Village Farmers’ Market
9025 Glover Road,
Fort Langley B.C.
1-604-728-2080
info@fortlangleyvillagefarmersmarket.org
April 10th – December 18th, 2021
Saturdays 9:00am – 3:00pm
Plus some Holiday Festival Markets…
Monday, August 3rd, MayDay in Fort Langley
Saturday, July 3rd Canada Day Weekend
Monday, August 3rd B.C. Day
Monday, Sept 7th Labour Day
Saturday, October 9th, Cranberry Day