Fort Langley Village Farmers’ Market
2021 Season
Saturdays
April 10th – December 18th – 9:00 AM – 3:00 PM
**************************************************
Join us at our next B.C. Farmers Market and meet our
local BC farmers, BC Prepared food vendors,
BC Craft beer, spirits, and wine vintners,
and our “Best of BC” Artisans.
Every Saturday 9:00 am – 3:00 pm. April 10th – December 18th, 2021
Our Market is located at:
9025 Glover Road
Fort Langley B.C.
(site of St. Andrew’s Historic Chapel)
~ <> ~
“Continuing Fort Langley’s Historic Trading Traditions”
At one point in history, Hudson Bay’s Fort Langley farm totalled over six thousand acres!
NOTE: (2021/05/01):
During the Covid-19 Emergency, our market is classified as an “essential food service” in BC.
We ask our customers to respect all BC CDC, COVID-19 Rules & Regulations.
Including:
At the entrance, at our customer greeting tents, we have sanitizers and a wash station available.
Customers are asked to shop at the market by walking one-way around, following the signs,
practicing 6′ social distancing, and stay in your individual or family “bubble” please.
(Up to ten persons presently allowed in each “family bubble”)
No stopping to gather & chat, nor group socializing, please!
Follow the red arrows that direct shoppers around the market.
Masks are now “required” for everyone!
Thank you for your support – Stay Healthy and Stay Safe in 2021.
Providing Local BC Farm Produce and BC Prepared Foods:
Fort Langley Village Farmers’ Market is an authentic B.C. Farmers’ Market and features Local Organic Farms and Certified Safe BC Prepared Food Vendors bringing in fresh local produce, field greens, vegetables, fruits, fresh baked bread & pastries, fruit pies, fresh baked cookies, local craft beer, varietal BC wines & Spirits, tasty prepared sauces & salad dressings, BC Fruit jams and pickles, all made with produce from our local Langley & Township, Fraser Valley, Similkameen, Okanagan and Creston Valley Farms.
2021 Fort Langley Farmers’ Market Season Vendors:
Please Note: Not all vendors attend each and every market.
New Vendors for 2021 are still being added.
B.C. Fresh Farm Produce, Fruits, Vegetables, Flowers & Plants:
– Wilde Wunder Gardens, Fresh field greens & vegetables, flowers, plants and fruits
– Christina’s Garden, Fresh local Langley greens, tomatoes, garlic, peppers, fruits & grapevines
– Black Table Farm, Fresh local Langley greens & vegetables
– Andor Farms, Fresh local Langley farm produce
– Coast to Coast Seafood, fresh and frozen seafood by Kevin
– Maan Farms, Fresh Langley Farm local fruit berries, and delicious berry wines
– J&D Farm, Orchids, Microgreens, fresh vegetables, and baking.
– Farm Werks, Vegetables, Eggs and fruits, by David Alsop
– Summer Breeze Farm, Fresh farm fruits brought to market from the Similkameen Valley
– Fresh Peonies, at the Market, June 10th, 17th, and lastly June 24th (Seasonal)
– Shepherd’s Haven Farm, Sheepskins, wool slippers, and Lamb Meats by order
– Tropical Hobbyist, Indoor Plants
B.C. Prepared Foods & Baking etc.
– The Bread Shop, Fresh baking by Amanda
– Golden Meadows Honey Farm, by Lydia
– Gabi & Jules, Homemade Pies, and Goodness, Baking
– Bakerlita, Keto and Gluten-free fresh baking and tarts
– Simply Delish Soups & Salads, Gourmet soups
– Gramma Ruth’s Home Made Cookies, By Gramma Ruth
– European Flavour Factory, by Vivian
– Oxford Ice Cream, by Andrea & Brendan, delicious natural flavours
– The Larks Nest, Fruit jams and pickles by Jackie Lark
– Hiveology, Okanagan Honey by Brad & Jennifer
– COCONAMA Chocolates, by Takanori Chiwata
– Fruit Butter’s, Jams, and Preserves, by Albert Seibold
– Gingeraki Gingershot, by 4Immunity
– Infusion Soy Sauces, by Jason Nichol
– BAK’D Cookies, by Jessica
– Amazing Foods BC, Fabulous Curries by Mandy
– Deb’s Best Kombucha, by Deb
– Jessica’s Gourmet Alfajores
– Zoomers Foods, Supercoffee by Todd
– Keto-Vego, Protein Bars
– Goldsmith Dressings, by Amber
– Damiani Fine Foods, by Sandra Damiani
– Scratch Fine Foods Fresh Koji and cultured Chili Sauces
– 3J’s Smokehouse – Island Jerky, by Michelle
– Maison Cote, huge variety of cooking spices with Jean-Pierre Cote
– Raphael’s Caribbean Spices, Delicious with chicken, beef or vegetable
– The Perogie Hut, Frozen perogies by Judy & Lawrence
– Hindi’s Finest Foods, Island flavours, Herb Meat and sweet pastries.
– Bon Mano Bon Foods, Chocolate nuts by Jason
– Boneheads Kitchen, Fresh foods and treats for dogs
– Bob the Dog, Dog food and treats
B.C. Craft Beers, Wines & Spirits:
– Trading Post Brewing, Local Craft beer from Langley
– Mariner Brewing, the Finest local craft beers
– Taynton Bay Spirits, from Invermere, BC
– Mainland Whisky,
– Crescent Hill Winery, delicious Okanagan wines, including vegan varietal
“Made in BC” Fresh Natural Soaps, Oils, Bath Products:
– Just Pure & Simple Bath & Body, Natural Soaps & Oils
– Ancient Mantra Naturals, by Raman Mand
– Natural Creams & Oils, by Marilyn
– Essentia Aromatherapy by Emily Taylor
B.C. Local Artisans, Painters, Arts & Crafts:
Not available in 2021 due to COVID-19 restrictions by the BC CDC
– “Pebbies and Gems”, by Ali
– “Jewelalicious” Hand Made Jewelry, by Debbie
– Sticks and Stones Art Works, by Jacqui Ross
– Strokes and Stitched, Paintings by Patty Ridley
– The Little House Company & Fort Langley Lathery, by Kevin & Susan McClain
– Whimsy’s Jewels, by Sasha Van De Keere
– Margaret’s Sew Cozy, by Margaret Ada
– Jan’s Pans and More, by Jan & Grace
– Tropical Hobbyist, by Arlene
– Unique Handcrafted & Repurposed Creations, by Shirley
– Rustic Rose All Naturals, by Rhonda, “A little Jar of Wow”
– Personal Touch Handcrafted, by Susan Purton
– Baroness Ashley Hats, by Michael Chung
– Rita Anderson, Watercolour Artist, Prints & Painting
– World of Difference Art, by Margaret Burns
– CARDS by EM, greeting cards and wedding invitations
– Mamma’s Little Man, Children’s clothing
– The 6th Scent Candle by Allie Lee
– Loving the Bling, by Val
Community Service Organisations
– United Churches of Langley, Friends of St. Andrew’s Chapel
– Fort Langley Lions Club
– Fort Langley Community Association
– Boundary Bay Vet Specialty Hospital, Blood Bank for Animals
– Rotary Club of Langley
– Langley Emergency Preparedness Program
– Heritage Fort Langley
– Fort Langley’s BC Farm Museum
– Fort Langley’s National Historic Fort, the Blacksmith.
=============================
Our Online Marketplace is here:
ORDER PRODUCTS ONLINECLICK HERE TO VISIT OUR STORE
Click the cart to Enter
============================
Vendors: Reserve your spaces now for the 2021 Season. Limited Spaces in every Category.
We are always looking for new 2021 Fort Langley Vendors in the following categories:
GET ON OUR VENDOR LISTS FOR 2021
Fort Langley Village Farmers’ Market 2021
info@fortlangleyvillagefarmersmarket.org
=========================================
Apply to get 2021 Vendor Registration Forms now:
or contact us at 604-728-2080 or send us an email request to info@fortlangleyvillagefarmersmarket.org
You must include name, phone number, vendor category, etc.
Thank you for your interest in our markets!
Fort Langley Village Farmers Market 2021
============================
604-728-2080
Member: B.C. Association of Farmers’ Markets
Member: Fort Langley Community Association
Member: BC Farm Museum
Member: Langley Emergency Preparedness Program
Member: Heritage Fort Langley
Fort Langley Village Farmers’ Market
9025 Glover Road,
Fort Langley B.C.
1-604-728-2080
info@fortlangleyvillagefarmersmarket.org
April 10th – December 18th, 2021
Saturdays 9:00am – 3:00pm
Plus some Holiday Festival Markets…
Monday, August 3rd, MayDay in Fort Langley
Saturday, July 3rd Canada Day Weekend
Monday, August 3rd B.C. Day
Monday, Sept 7th Labour Day
Saturday, October 9th, Cranberry Day